VCAM-1 Promotes Angiogenesis of Bone Marrow Mesenchymal Stem Cells Derived from Patients with Trauma-Induced Osteonecrosis of the Femoral Head by Regulating the Apelin/CCN2 Pathway
Trauma-induced osteonecrosis of the femoral head (TI-ONFH) is a pathological process in which the destruction of blood vessels supplying blood to the femoral head causes the death of bone tissue cells. Vascular cell adhesion molecule 1 (VCAM-1) has been shown to have potent proangiogenic activity, b...
Saved in:
| Main Authors: | , , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Wiley
2023-01-01
|
| Series: | Stem Cells International |
| Online Access: | http://dx.doi.org/10.1155/2023/6684617 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1832553051234238464 |
|---|---|
| author | Yiming Shao Lei Sun Baodong Ma Ranran Jin Yueyao Ban Ruibo Li Jianfa Wang Hongkai Lian Han Yue |
| author_facet | Yiming Shao Lei Sun Baodong Ma Ranran Jin Yueyao Ban Ruibo Li Jianfa Wang Hongkai Lian Han Yue |
| author_sort | Yiming Shao |
| collection | DOAJ |
| description | Trauma-induced osteonecrosis of the femoral head (TI-ONFH) is a pathological process in which the destruction of blood vessels supplying blood to the femoral head causes the death of bone tissue cells. Vascular cell adhesion molecule 1 (VCAM-1) has been shown to have potent proangiogenic activity, but the role in angiogenesis of TI-ONFH is unclear. In this work, we discovered that VCAM-1 was significantly downregulated in the bone marrow mesenchymal stem cells (BMSCs) derived from patients with TI-ONFH. Subsequently, we constructed BMSCs overexpressing VCAM-1 using a lentiviral vector. VCAM-1 enhances the migration and angiogenesis of BMSCs. We further performed mRNA transcriptome sequencing to explore the mechanisms by which VCAM-1 promotes angiogenesis. Gene ontology biological process enrichment analysis demonstrated that upregulated differentially expressed genes (DEGs) were related to blood vessel development. Kyoto Encyclopedia of Genes and Genomes pathway enrichment analysis revealed that upregulated DEGs were engaged in the Apelin signaling pathway. Apelin-13 is the endogenous ligand of the APJ receptor and activates this G protein-coupled receptor. Treatment with Apelin-13 activated the Apelin signaling pathway and suppressed the expression of cellular communication network factor 2 in BMSCs. Furthermore, Apelin-13 also inhibits the migration and angiogenesis of VCAM-1-BMSCs. In summary, VCAM-1 plays an important role in vascular microcirculation disorders of TI-ONFH, which provides a new direction for the molecular mechanism and treatment of TI-ONFH. |
| format | Article |
| id | doaj-art-3f7bdb3b86814646ab5959c77f1986dd |
| institution | Kabale University |
| issn | 1687-9678 |
| language | English |
| publishDate | 2023-01-01 |
| publisher | Wiley |
| record_format | Article |
| series | Stem Cells International |
| spelling | doaj-art-3f7bdb3b86814646ab5959c77f1986dd2025-02-03T05:57:01ZengWileyStem Cells International1687-96782023-01-01202310.1155/2023/6684617VCAM-1 Promotes Angiogenesis of Bone Marrow Mesenchymal Stem Cells Derived from Patients with Trauma-Induced Osteonecrosis of the Femoral Head by Regulating the Apelin/CCN2 PathwayYiming Shao0Lei Sun1Baodong Ma2Ranran Jin3Yueyao Ban4Ruibo Li5Jianfa Wang6Hongkai Lian7Han Yue8Department of OrthopedicsCenter of Stem Cell and Regenerative MedicineCenter of Stem Cell and Regenerative MedicineCenter of Stem Cell and Regenerative MedicineDepartment of Trauma SurgeryDepartment of Trauma SurgeryDepartment of OrthopedicsDepartment of OrthopedicsCenter of Stem Cell and Regenerative MedicineTrauma-induced osteonecrosis of the femoral head (TI-ONFH) is a pathological process in which the destruction of blood vessels supplying blood to the femoral head causes the death of bone tissue cells. Vascular cell adhesion molecule 1 (VCAM-1) has been shown to have potent proangiogenic activity, but the role in angiogenesis of TI-ONFH is unclear. In this work, we discovered that VCAM-1 was significantly downregulated in the bone marrow mesenchymal stem cells (BMSCs) derived from patients with TI-ONFH. Subsequently, we constructed BMSCs overexpressing VCAM-1 using a lentiviral vector. VCAM-1 enhances the migration and angiogenesis of BMSCs. We further performed mRNA transcriptome sequencing to explore the mechanisms by which VCAM-1 promotes angiogenesis. Gene ontology biological process enrichment analysis demonstrated that upregulated differentially expressed genes (DEGs) were related to blood vessel development. Kyoto Encyclopedia of Genes and Genomes pathway enrichment analysis revealed that upregulated DEGs were engaged in the Apelin signaling pathway. Apelin-13 is the endogenous ligand of the APJ receptor and activates this G protein-coupled receptor. Treatment with Apelin-13 activated the Apelin signaling pathway and suppressed the expression of cellular communication network factor 2 in BMSCs. Furthermore, Apelin-13 also inhibits the migration and angiogenesis of VCAM-1-BMSCs. In summary, VCAM-1 plays an important role in vascular microcirculation disorders of TI-ONFH, which provides a new direction for the molecular mechanism and treatment of TI-ONFH.http://dx.doi.org/10.1155/2023/6684617 |
| spellingShingle | Yiming Shao Lei Sun Baodong Ma Ranran Jin Yueyao Ban Ruibo Li Jianfa Wang Hongkai Lian Han Yue VCAM-1 Promotes Angiogenesis of Bone Marrow Mesenchymal Stem Cells Derived from Patients with Trauma-Induced Osteonecrosis of the Femoral Head by Regulating the Apelin/CCN2 Pathway Stem Cells International |
| title | VCAM-1 Promotes Angiogenesis of Bone Marrow Mesenchymal Stem Cells Derived from Patients with Trauma-Induced Osteonecrosis of the Femoral Head by Regulating the Apelin/CCN2 Pathway |
| title_full | VCAM-1 Promotes Angiogenesis of Bone Marrow Mesenchymal Stem Cells Derived from Patients with Trauma-Induced Osteonecrosis of the Femoral Head by Regulating the Apelin/CCN2 Pathway |
| title_fullStr | VCAM-1 Promotes Angiogenesis of Bone Marrow Mesenchymal Stem Cells Derived from Patients with Trauma-Induced Osteonecrosis of the Femoral Head by Regulating the Apelin/CCN2 Pathway |
| title_full_unstemmed | VCAM-1 Promotes Angiogenesis of Bone Marrow Mesenchymal Stem Cells Derived from Patients with Trauma-Induced Osteonecrosis of the Femoral Head by Regulating the Apelin/CCN2 Pathway |
| title_short | VCAM-1 Promotes Angiogenesis of Bone Marrow Mesenchymal Stem Cells Derived from Patients with Trauma-Induced Osteonecrosis of the Femoral Head by Regulating the Apelin/CCN2 Pathway |
| title_sort | vcam 1 promotes angiogenesis of bone marrow mesenchymal stem cells derived from patients with trauma induced osteonecrosis of the femoral head by regulating the apelin ccn2 pathway |
| url | http://dx.doi.org/10.1155/2023/6684617 |
| work_keys_str_mv | AT yimingshao vcam1promotesangiogenesisofbonemarrowmesenchymalstemcellsderivedfrompatientswithtraumainducedosteonecrosisofthefemoralheadbyregulatingtheapelinccn2pathway AT leisun vcam1promotesangiogenesisofbonemarrowmesenchymalstemcellsderivedfrompatientswithtraumainducedosteonecrosisofthefemoralheadbyregulatingtheapelinccn2pathway AT baodongma vcam1promotesangiogenesisofbonemarrowmesenchymalstemcellsderivedfrompatientswithtraumainducedosteonecrosisofthefemoralheadbyregulatingtheapelinccn2pathway AT ranranjin vcam1promotesangiogenesisofbonemarrowmesenchymalstemcellsderivedfrompatientswithtraumainducedosteonecrosisofthefemoralheadbyregulatingtheapelinccn2pathway AT yueyaoban vcam1promotesangiogenesisofbonemarrowmesenchymalstemcellsderivedfrompatientswithtraumainducedosteonecrosisofthefemoralheadbyregulatingtheapelinccn2pathway AT ruiboli vcam1promotesangiogenesisofbonemarrowmesenchymalstemcellsderivedfrompatientswithtraumainducedosteonecrosisofthefemoralheadbyregulatingtheapelinccn2pathway AT jianfawang vcam1promotesangiogenesisofbonemarrowmesenchymalstemcellsderivedfrompatientswithtraumainducedosteonecrosisofthefemoralheadbyregulatingtheapelinccn2pathway AT hongkailian vcam1promotesangiogenesisofbonemarrowmesenchymalstemcellsderivedfrompatientswithtraumainducedosteonecrosisofthefemoralheadbyregulatingtheapelinccn2pathway AT hanyue vcam1promotesangiogenesisofbonemarrowmesenchymalstemcellsderivedfrompatientswithtraumainducedosteonecrosisofthefemoralheadbyregulatingtheapelinccn2pathway |