Survivin Interference and SurVaxM as an Adjunct Therapy for Glioblastoma Multiforme by Willie James Elliott, Nandini Gurramkonda, Maheedhara R. Guda, Andrew J. Tsung, Kiran K. Velpula

Subjects: “…SurVaxM…”
Get full text

QadirVax-19: A multi epitope-based vaccine against COVID-19 by Misha Mukhtar, Professor (Associate) Muhammad Imran Qadir

“…The sequence of the multi-epitope construct finally came out as LQYGSFCTQLNRGPGPGTFGAGAALQGPGPGNFTTAPAICGPGPGHWFVTQRNFAAYQYIKWPWYI. It was named as QadirVax-19. Multi-epitope construct was highly antigenic along with proteasomal cleavage sites and full population coverage. …”
Get full text

Addressing vaccine hesitancy in the training of healthcare professionals: Insights from the VAX-TRUST project by Fábio Rafael Augusto, Cátia Sá Guerreiro, Rita Morais, Joana Mendonça, André Beja, Tiago Correia, Ana Patrícia Hilário

“…In line with the scientific evidence gathered from the VAX-TRUST project, it is crucial to invest in training healthcare professionals and developing political measures to effectively address vaccine hesitancy. …”
Get full text

Development of a next-generation chikungunya virus vaccine based on the HydroVax platform. by Dawn K Slifka, Hans-Peter Raué, Whitney C Weber, Takeshi F Andoh, Craig N Kreklywich, Victor R DeFilippis, Daniel N Streblow, Mark K Slifka, Ian J Amanna

“…Heat, UV, and BPL were efficient at inactivating CHIKV-181/25 but caused substantial damage to neutralizing epitopes and failed to induce high-titer neutralizing antibodies in vaccinated mice. HydroVax-CHIKV and formaldehyde-inactivated CHIKV retained intact neutralizing epitopes similar to live virus controls but the HydroVax-CHIKV approach demonstrated a more rapid rate of virus inactivation. …”
Get full text

Predictive BlockVax Distribution: Enhancing Healthcare Supply Chain Resilience with Blockchain and LSTM by Raji Ramakrishnan Nair, Punam Rattan, Mukesh Kumar, Vivek Bhardwaj

“…This research proposes a novel framework that merges Blockchain (BC) and Machine Learning (ML) to bolster the HSCs amidst pandemics, by developing a framework named the Predictive BlockVax Distribution Network (PBDN) model. The proposed PBDN model utilizes BC for securing transactions and Long Short-Term Memory (LSTM), for precise demand prediction. …”
Get full text

خصوصیات فیزیکوشیمیایی و ایمونولوژیکی RiVax بارگذاری شده در نانوذرات PLGA by داود صادقی, مصطفی بخشی, میر مرتضی سادات ابراهیمی, شهرام نظریان, مهدی زین الدینی

“…دو کاندید واکسن پروتئینی بر پایه زنجیره A شامل RiVax و RVEc بر مقابله با مسمومیت ناشی از این سم وجود دارد. …”
Get full text

SMS-Based Active Surveillance of Adverse Events following Immunization in Children: The VigiVax Study by Laura Augusta Gonella, Francesca Moretti, Annalisa Capuano, Caterina De Sarro, Lorenza Ferrara, Elisabetta Geninatti, Greta Guarnieri, Xhikjana Hysolakoj, Margherita Lalli, Olivia Leoni, Antea Maria Pia Mangano, Patrizia Marani Toro, Viviana Mecchia, Maria Caterina Merlano, Caterina Palleria, Anna Maria Potenza, Paola Rossi, Marco Rossi, Francesca Sanità, Ester Sapigni, Cristina Scavone, Claudia Sommaro, Marco Tuccori, Giovanna Zanoni, Ugo Moretti, VigiVax Working Group

“…This cohort-event monitoring study aims to examine the potential of short message service (SMS)-based surveillance compared to traditional surveillance systems. Using VigiVax software, parents of vaccinated children aged two years or younger, in the period March 2021–May 2022, received a single SMS inquiry about adverse events following immunization (AEFI). …”
Get full text

Psychometric validation of the Vaccination Attitudes Examination (VAX) scale in German pre-pandemic and mid-pandemic samples by Marcel Wilhelm, Friederike L. Bender, Frank Euteneuer, Stefan Salzmann, Anne-Catherine I. Ewen, Winfried Rief

Subjects: Get full text

Development and validation of an Arabic tool for assessment of post-vaccination confidence in COVID-19 vaccines (ARAB-VAX-CONF) by Rowan Abuyadek, Samar Abd ElHafeez, Mohamed Mostafa Tahoun, Sally Samir Othman, Abdelrahman Omran, Naglaa Fathy, Ramy Mohamed Ghazy

“…The objective of this study was to develop and validate an Arabic tool to evaluate confidence in the received coronavirus disease 2019 (COVID-19) vaccines (ARAB-VAX-CONF). Methods The research team developed the ARAB-VAX-CONF based on three areas specified by the Centers for Disease Control and Prevention (CDC): confidence in vaccine effectiveness, confidence in vaccine safety, and confidence in the healthcare system. …”
Get full text

Validity and Reliability of the Persian Version of the Vaccine Attitude Examination (p-VAX) Scale among Iranian Older Adults by Nastaran Talavari, Zhaleh Zandieh, Marjan Haghi, Mojtaba Azadbakht, Sorour Sarvari

“…Conclusion The final form of the Persian version of the VAX instrument has 12 items, whose face and content validity is confirmed. …”
Get full text

Vaccination with synthetic long peptide and CpG 2395 in AddaVax induces potent anti-tumor effects by Shanshan Jiang, Shuqi Zhao, Qiaojiajie Zhao, Yinfang Wang, Weihua Zhang, Yangmeng Feng, Lijie Zhang

Subjects: “…AddaVax…”
Get full text

Stratégies rhétoriques pour contrer les discours conspirationnistes anti-vax (Covid-19) : la campagne #ThinkBeforeSharing by Roberta Martina Zagarella, Marco Annoni

Get full text

Using mobile technology to increase adherence to sublingual immunotherapy: Real-world study with a new app/web platform AllergyVax® by Matheus Fonseca Aarestrup, MD, Akinori Cardozo Nagato, PhD, Paula Fonseca Aarestrup, MD, Edir Paula Cheloni, MD, Beatriz Julião V. Aarestrup, PhD, José Otávio Amaral Correa, PhD, Fernando Monteiro Aarestrup, MD PhD

“…This study evaluates the efficacy of a mobile application (app/web platform) AllergyVax®, designed to implement a patient-centered care (PCC) strategy to increase patient engagement in the treatment. …”
Get full text

Adverse Events and Associated Economic Burden of COVID-19 Vaccination in Queensland, Australia: Findings from the Cross-Sectional QoVAX-Statewide Study by Qing Xia, Kerry-Ann F. O’Grady, Peter Vardon, Selina Ward, Rebecca Gregory, Janet Davies, Hannah E. Carter

Get full text

A Comparison of Tests for Detecting Prior Exposure to <i>Coxiella burnetii</i> for Use with Q-VAX in Australian Human Q Fever Vaccination by Stephen Graves, Jennifer Robson, Anja Scholzen, Richard Dzeng, Francisca Powell-Romero, Jennifer Evans, John Stenos, Meg Jeppesen, Milou L. C. E. Kouwijzer, Jordi Lankhof, Susan Raju Paul, Tatiana Proboste Ibertti, Lauren Ball, Helen Powell, Stephanie Wilkinson, Evi van Schuppen, Willemijn J. Anker-Op den Brouw, Rowland Cobbold, Anja Garritsen, Mark C. Poznansky, Ann E. Sluder

“…Background/Objectives: Q-VAX vaccine, approved in Australia, prevents Q fever. …”
Get full text

Simulation-based assessment of digital twin systems for immunisation by Leonardo de Oliveira El-Warrak, Claudio Miceli de Farias, Victor Hugo Dias Macedo De Azevedo Costa

Subjects: Get full text

FACTORS INFLUENCING AND CONTROL STRATEGIES AGAINST LUMPY SKIN DISEASE THROUGH VACCINATIONS ON BOVINE by W. M. Mangrio, S. A. Rid, H. A. Sahito, F. I. Sahito, A. H. Mastoi

Subjects: Get full text

TWINVAX: conceptual model of a digital twin for immunisation services in primary health care by L. De Oliveira El-Warrak, C. Miceli de Farias

Subjects: Get full text

Evaluation of the influenza vaccine protection in the house dust mite-induced chronic allergic asthma mice model and the evaluation of squalene oil in water emulsion as an adjuvant... by So Yeon Ahn, Thi Len Ho, Eun-Ju Ko

Subjects: Get full text

A phase 4, open-label study to evaluate the safety and immunogenicity of DTaP5-HBV-IPV-Hib in children previously vaccinated with DTaP2-HBV-IPV-Hib or DTaP5-HBV-IPV-Hib (V419-016) by Andrea Guerra, Claudio Costantino, Federico Martinon-Torres, Soeren Westerholt, Courtney Lambeth, Ziqiang Chen, Jessie Lumley, Tomas Marcek, David Johnson, Marissa Wilck

Subjects: “…Vaxelis…”
Get full text