Dopamine Suppresses Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells via AKT/GSK-3β/β-Catenin Signaling Pathway
Nervous system is critically involved in bone homeostasis and osteogenesis. Dopamine, a pivotal neurotransmitter, plays a crucial role in sympathetic regulation, hormone secretion, immune activation, and blood pressure regulation. However, the role of dopamine on osteogenic differentiation of rat bo...
Saved in:
| Main Authors: | , , , , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Wiley
2022-01-01
|
| Series: | Stem Cells International |
| Online Access: | http://dx.doi.org/10.1155/2022/4154440 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1832565758447583232 |
|---|---|
| author | Zhili Kuang Zheng Chen Shaoqin Tu Zhihui Mai Lin Chen Xiaoning Kang Xiaochuan Chen Jiaming Wei Yuxuan Wang Yun Peng Hong Ai |
| author_facet | Zhili Kuang Zheng Chen Shaoqin Tu Zhihui Mai Lin Chen Xiaoning Kang Xiaochuan Chen Jiaming Wei Yuxuan Wang Yun Peng Hong Ai |
| author_sort | Zhili Kuang |
| collection | DOAJ |
| description | Nervous system is critically involved in bone homeostasis and osteogenesis. Dopamine, a pivotal neurotransmitter, plays a crucial role in sympathetic regulation, hormone secretion, immune activation, and blood pressure regulation. However, the role of dopamine on osteogenic differentiation of rat bone marrow-derived mesenchymal stem cells (rBMSCs) remains poorly understood. In this study, we firstly investigated the effect of dopamine on the apoptosis, proliferation, and osteogenic differentiation of rBMSCs. Dopamine did not, however, interfere with the apoptosis and proliferation of rBMSCs. Interestingly, dopamine suppressed the osteogenic differentiation of rBMSCs, as characterized by reduced ALP staining, ALP activity, mineralized nodule formation, and the mRNA and protein levels of osteogenesis-related genes (Col1a1, Alp, Runx2, Opn, and Ocn). Furthermore, dopamine inactivated AKT/GSK-3β/β-catenin signaling pathway. Treatment of LiCl (GSK-3β inhibitor) rescued the inhibitory effects of dopamine on osteogenic differentiation of rBMSCs. LY294002 (AKT inhibitor) administration exacerbated the inhibitory effects of dopamine on osteogenic differentiation of rBMSCs. Taken together, these findings indicate that dopamine suppresses osteogenic differentiation of rBMSCs via AKT/GSK-3β/β-catenin signaling pathway. Our study provides new insights into the role of neurotransmitters in bone homeostasis. |
| format | Article |
| id | doaj-art-f9c2c3022ee94476ba3e08f783cd19dc |
| institution | Kabale University |
| issn | 1687-9678 |
| language | English |
| publishDate | 2022-01-01 |
| publisher | Wiley |
| record_format | Article |
| series | Stem Cells International |
| spelling | doaj-art-f9c2c3022ee94476ba3e08f783cd19dc2025-02-03T01:06:47ZengWileyStem Cells International1687-96782022-01-01202210.1155/2022/4154440Dopamine Suppresses Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells via AKT/GSK-3β/β-Catenin Signaling PathwayZhili Kuang0Zheng Chen1Shaoqin Tu2Zhihui Mai3Lin Chen4Xiaoning Kang5Xiaochuan Chen6Jiaming Wei7Yuxuan Wang8Yun Peng9Hong Ai10Department of StomatologyDepartment of StomatologyDepartment of StomatologyDepartment of StomatologyDepartment of StomatologyDepartment of StomatologyDepartment of StomatologyDepartment of StomatologyDepartment of StomatologyGuangdong Provincial Key Laboratory of StomatologyDepartment of StomatologyNervous system is critically involved in bone homeostasis and osteogenesis. Dopamine, a pivotal neurotransmitter, plays a crucial role in sympathetic regulation, hormone secretion, immune activation, and blood pressure regulation. However, the role of dopamine on osteogenic differentiation of rat bone marrow-derived mesenchymal stem cells (rBMSCs) remains poorly understood. In this study, we firstly investigated the effect of dopamine on the apoptosis, proliferation, and osteogenic differentiation of rBMSCs. Dopamine did not, however, interfere with the apoptosis and proliferation of rBMSCs. Interestingly, dopamine suppressed the osteogenic differentiation of rBMSCs, as characterized by reduced ALP staining, ALP activity, mineralized nodule formation, and the mRNA and protein levels of osteogenesis-related genes (Col1a1, Alp, Runx2, Opn, and Ocn). Furthermore, dopamine inactivated AKT/GSK-3β/β-catenin signaling pathway. Treatment of LiCl (GSK-3β inhibitor) rescued the inhibitory effects of dopamine on osteogenic differentiation of rBMSCs. LY294002 (AKT inhibitor) administration exacerbated the inhibitory effects of dopamine on osteogenic differentiation of rBMSCs. Taken together, these findings indicate that dopamine suppresses osteogenic differentiation of rBMSCs via AKT/GSK-3β/β-catenin signaling pathway. Our study provides new insights into the role of neurotransmitters in bone homeostasis.http://dx.doi.org/10.1155/2022/4154440 |
| spellingShingle | Zhili Kuang Zheng Chen Shaoqin Tu Zhihui Mai Lin Chen Xiaoning Kang Xiaochuan Chen Jiaming Wei Yuxuan Wang Yun Peng Hong Ai Dopamine Suppresses Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells via AKT/GSK-3β/β-Catenin Signaling Pathway Stem Cells International |
| title | Dopamine Suppresses Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells via AKT/GSK-3β/β-Catenin Signaling Pathway |
| title_full | Dopamine Suppresses Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells via AKT/GSK-3β/β-Catenin Signaling Pathway |
| title_fullStr | Dopamine Suppresses Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells via AKT/GSK-3β/β-Catenin Signaling Pathway |
| title_full_unstemmed | Dopamine Suppresses Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells via AKT/GSK-3β/β-Catenin Signaling Pathway |
| title_short | Dopamine Suppresses Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells via AKT/GSK-3β/β-Catenin Signaling Pathway |
| title_sort | dopamine suppresses osteogenic differentiation of rat bone marrow derived mesenchymal stem cells via akt gsk 3β β catenin signaling pathway |
| url | http://dx.doi.org/10.1155/2022/4154440 |
| work_keys_str_mv | AT zhilikuang dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway AT zhengchen dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway AT shaoqintu dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway AT zhihuimai dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway AT linchen dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway AT xiaoningkang dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway AT xiaochuanchen dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway AT jiamingwei dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway AT yuxuanwang dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway AT yunpeng dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway AT hongai dopaminesuppressesosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsviaaktgsk3bbcateninsignalingpathway |