Relationship between Self-Efficacy and Headache Impact, Anxiety, and Physical Activity Levels in Patients with Chronic Tension-Type Headache: An Observational Study
Background. Chronic tension-type headache is the primary headache with the highest prevalence. The present study is aimed at analyzing the associations between patient self-efficacy and headache impact with pain characteristics, kinesiophobia, anxiety sensitivity, and physical activity levels in sub...
Saved in:
| Main Authors: | , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Wiley
2022-01-01
|
| Series: | Behavioural Neurology |
| Online Access: | http://dx.doi.org/10.1155/2022/8387249 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1832562362208485376 |
|---|---|
| author | Ángel González de la Flor Guillermo García Pérez de Sevilla Diego Domíngez Balmaseda Daniel Martín Vera María Montero Martínez Jose Ángel Del Blanco Muñiz |
| author_facet | Ángel González de la Flor Guillermo García Pérez de Sevilla Diego Domíngez Balmaseda Daniel Martín Vera María Montero Martínez Jose Ángel Del Blanco Muñiz |
| author_sort | Ángel González de la Flor |
| collection | DOAJ |
| description | Background. Chronic tension-type headache is the primary headache with the highest prevalence. The present study is aimed at analyzing the associations between patient self-efficacy and headache impact with pain characteristics, kinesiophobia, anxiety sensitivity, and physical activity levels in subjects with chronic tension-type headache. Materials and Methods. An observational descriptive study was carried out. A total sample of 42 participants was recruited at university environment with diagnosis of tension-type headache. Headache characteristics (frequency, intensity, and duration), physical activity levels, pain related-self-efficacy, kinesiophobia, anxiety sensitivity, and headache impact were measured. Results. The HIT-6 (61.05±6.38) score showed significant moderate positive correlations with the ASI-3 score (17.64±16.22; r=0.47) and moderate negative correlations with the self-efficacy in the domains of pain management (31.9±10.28; r=−0.43) and coping with symptoms (53.81±14.19; r=−0.47). ASI-3 score had a negative large correlation with self-efficacy in the domains of pain management (r=−0.59), physical function (53.36±7.99; r=−0.55), and coping with symptoms (r=−0.68). Physical activity levels showed positive moderate correlations with the self-efficacy in the domain of physical function (r=0.41). Linear regression models determined that the self-efficacy and anxiety sensitivity with showed a significant relationship with the HIT-6 score (R2=0.262;p=0.008) and with the ASI-3 score (R2=0.565; p<0.001). In addition, no correlations were found between pain intensity, duration or frecuency with psychosocial factors, or headache impact. Conclusions. The present study showed that patients with chronic tension-type headache had a great negative impact on daily tasks and physical activity levels, which were associated with higher anxiety levels and lower self-efficacy. |
| format | Article |
| id | doaj-art-afb8b9cbc62949048c066ac3e248bfaf |
| institution | Kabale University |
| issn | 1875-8584 |
| language | English |
| publishDate | 2022-01-01 |
| publisher | Wiley |
| record_format | Article |
| series | Behavioural Neurology |
| spelling | doaj-art-afb8b9cbc62949048c066ac3e248bfaf2025-02-03T01:22:49ZengWileyBehavioural Neurology1875-85842022-01-01202210.1155/2022/8387249Relationship between Self-Efficacy and Headache Impact, Anxiety, and Physical Activity Levels in Patients with Chronic Tension-Type Headache: An Observational StudyÁngel González de la Flor0Guillermo García Pérez de Sevilla1Diego Domíngez Balmaseda2Daniel Martín Vera3María Montero Martínez4Jose Ángel Del Blanco Muñiz5Faculty of Sport SciencesFaculty of Sport SciencesFaculty of Sport SciencesFaculty of Sport SciencesFaculty of BiomedicineFaculty of Sport SciencesBackground. Chronic tension-type headache is the primary headache with the highest prevalence. The present study is aimed at analyzing the associations between patient self-efficacy and headache impact with pain characteristics, kinesiophobia, anxiety sensitivity, and physical activity levels in subjects with chronic tension-type headache. Materials and Methods. An observational descriptive study was carried out. A total sample of 42 participants was recruited at university environment with diagnosis of tension-type headache. Headache characteristics (frequency, intensity, and duration), physical activity levels, pain related-self-efficacy, kinesiophobia, anxiety sensitivity, and headache impact were measured. Results. The HIT-6 (61.05±6.38) score showed significant moderate positive correlations with the ASI-3 score (17.64±16.22; r=0.47) and moderate negative correlations with the self-efficacy in the domains of pain management (31.9±10.28; r=−0.43) and coping with symptoms (53.81±14.19; r=−0.47). ASI-3 score had a negative large correlation with self-efficacy in the domains of pain management (r=−0.59), physical function (53.36±7.99; r=−0.55), and coping with symptoms (r=−0.68). Physical activity levels showed positive moderate correlations with the self-efficacy in the domain of physical function (r=0.41). Linear regression models determined that the self-efficacy and anxiety sensitivity with showed a significant relationship with the HIT-6 score (R2=0.262;p=0.008) and with the ASI-3 score (R2=0.565; p<0.001). In addition, no correlations were found between pain intensity, duration or frecuency with psychosocial factors, or headache impact. Conclusions. The present study showed that patients with chronic tension-type headache had a great negative impact on daily tasks and physical activity levels, which were associated with higher anxiety levels and lower self-efficacy.http://dx.doi.org/10.1155/2022/8387249 |
| spellingShingle | Ángel González de la Flor Guillermo García Pérez de Sevilla Diego Domíngez Balmaseda Daniel Martín Vera María Montero Martínez Jose Ángel Del Blanco Muñiz Relationship between Self-Efficacy and Headache Impact, Anxiety, and Physical Activity Levels in Patients with Chronic Tension-Type Headache: An Observational Study Behavioural Neurology |
| title | Relationship between Self-Efficacy and Headache Impact, Anxiety, and Physical Activity Levels in Patients with Chronic Tension-Type Headache: An Observational Study |
| title_full | Relationship between Self-Efficacy and Headache Impact, Anxiety, and Physical Activity Levels in Patients with Chronic Tension-Type Headache: An Observational Study |
| title_fullStr | Relationship between Self-Efficacy and Headache Impact, Anxiety, and Physical Activity Levels in Patients with Chronic Tension-Type Headache: An Observational Study |
| title_full_unstemmed | Relationship between Self-Efficacy and Headache Impact, Anxiety, and Physical Activity Levels in Patients with Chronic Tension-Type Headache: An Observational Study |
| title_short | Relationship between Self-Efficacy and Headache Impact, Anxiety, and Physical Activity Levels in Patients with Chronic Tension-Type Headache: An Observational Study |
| title_sort | relationship between self efficacy and headache impact anxiety and physical activity levels in patients with chronic tension type headache an observational study |
| url | http://dx.doi.org/10.1155/2022/8387249 |
| work_keys_str_mv | AT angelgonzalezdelaflor relationshipbetweenselfefficacyandheadacheimpactanxietyandphysicalactivitylevelsinpatientswithchronictensiontypeheadacheanobservationalstudy AT guillermogarciaperezdesevilla relationshipbetweenselfefficacyandheadacheimpactanxietyandphysicalactivitylevelsinpatientswithchronictensiontypeheadacheanobservationalstudy AT diegodomingezbalmaseda relationshipbetweenselfefficacyandheadacheimpactanxietyandphysicalactivitylevelsinpatientswithchronictensiontypeheadacheanobservationalstudy AT danielmartinvera relationshipbetweenselfefficacyandheadacheimpactanxietyandphysicalactivitylevelsinpatientswithchronictensiontypeheadacheanobservationalstudy AT mariamonteromartinez relationshipbetweenselfefficacyandheadacheimpactanxietyandphysicalactivitylevelsinpatientswithchronictensiontypeheadacheanobservationalstudy AT joseangeldelblancomuniz relationshipbetweenselfefficacyandheadacheimpactanxietyandphysicalactivitylevelsinpatientswithchronictensiontypeheadacheanobservationalstudy |