The Problem of Abnormal Body Weight and Dyslipidemia as Risk Factors for Cardiovascular Diseases in Children and Adolescents with Type 1 Diabetes
Diabetes is a disease that affects many people around the world. Its complications are the cause of cardiovascular diseases (CVD) and increased mortality. That is why the search for predictive biomarkers is so important. The aim of the study was to show the prevalence of the problem and risk factors...
Saved in:
| Main Authors: | , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Wiley
2021-01-01
|
| Series: | Journal of Diabetes Research |
| Online Access: | http://dx.doi.org/10.1155/2021/5555149 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1832556491483119616 |
|---|---|
| author | Katarzyna Noras Ewa Rusak Przemysława Jarosz-Chobot |
| author_facet | Katarzyna Noras Ewa Rusak Przemysława Jarosz-Chobot |
| author_sort | Katarzyna Noras |
| collection | DOAJ |
| description | Diabetes is a disease that affects many people around the world. Its complications are the cause of cardiovascular diseases (CVD) and increased mortality. That is why the search for predictive biomarkers is so important. The aim of the study was to show the prevalence of the problem and risk factors in children and adolescents with type 1 diabetes. These patients are often overweight and obese, and the percentage of lipid disorders is particularly high. The discussed markers of CVD risk in type 1 diabetes include apolipoproteins (apo-B and apo-C3), modified forms of LDL, and the role of high-density lipoprotein (HDL). Recently, a new look at the vasoprotective effect of HDL has appeared, which due to its dysfunctional form in type 1 diabetes may not protect against cardiovascular risk. The HDL proteome in type 1 diabetes has an altered protein composition compared to the healthy population. Another direction of research is determining the importance of trace elements (mainly Mg) in the development of diabetes complications. |
| format | Article |
| id | doaj-art-afb66d90c0a04051a5b9358b7c7c5d39 |
| institution | Kabale University |
| issn | 2314-6745 2314-6753 |
| language | English |
| publishDate | 2021-01-01 |
| publisher | Wiley |
| record_format | Article |
| series | Journal of Diabetes Research |
| spelling | doaj-art-afb66d90c0a04051a5b9358b7c7c5d392025-02-03T05:45:19ZengWileyJournal of Diabetes Research2314-67452314-67532021-01-01202110.1155/2021/55551495555149The Problem of Abnormal Body Weight and Dyslipidemia as Risk Factors for Cardiovascular Diseases in Children and Adolescents with Type 1 DiabetesKatarzyna Noras0Ewa Rusak1Przemysława Jarosz-Chobot2Department of Children’s Diabetology, Upper Silesian Child Health Centre, Katowice, PolandDepartment of Children’s Diabetology, Medical University of Silesia, Katowice, PolandDepartment of Children’s Diabetology, Medical University of Silesia, Katowice, PolandDiabetes is a disease that affects many people around the world. Its complications are the cause of cardiovascular diseases (CVD) and increased mortality. That is why the search for predictive biomarkers is so important. The aim of the study was to show the prevalence of the problem and risk factors in children and adolescents with type 1 diabetes. These patients are often overweight and obese, and the percentage of lipid disorders is particularly high. The discussed markers of CVD risk in type 1 diabetes include apolipoproteins (apo-B and apo-C3), modified forms of LDL, and the role of high-density lipoprotein (HDL). Recently, a new look at the vasoprotective effect of HDL has appeared, which due to its dysfunctional form in type 1 diabetes may not protect against cardiovascular risk. The HDL proteome in type 1 diabetes has an altered protein composition compared to the healthy population. Another direction of research is determining the importance of trace elements (mainly Mg) in the development of diabetes complications.http://dx.doi.org/10.1155/2021/5555149 |
| spellingShingle | Katarzyna Noras Ewa Rusak Przemysława Jarosz-Chobot The Problem of Abnormal Body Weight and Dyslipidemia as Risk Factors for Cardiovascular Diseases in Children and Adolescents with Type 1 Diabetes Journal of Diabetes Research |
| title | The Problem of Abnormal Body Weight and Dyslipidemia as Risk Factors for Cardiovascular Diseases in Children and Adolescents with Type 1 Diabetes |
| title_full | The Problem of Abnormal Body Weight and Dyslipidemia as Risk Factors for Cardiovascular Diseases in Children and Adolescents with Type 1 Diabetes |
| title_fullStr | The Problem of Abnormal Body Weight and Dyslipidemia as Risk Factors for Cardiovascular Diseases in Children and Adolescents with Type 1 Diabetes |
| title_full_unstemmed | The Problem of Abnormal Body Weight and Dyslipidemia as Risk Factors for Cardiovascular Diseases in Children and Adolescents with Type 1 Diabetes |
| title_short | The Problem of Abnormal Body Weight and Dyslipidemia as Risk Factors for Cardiovascular Diseases in Children and Adolescents with Type 1 Diabetes |
| title_sort | problem of abnormal body weight and dyslipidemia as risk factors for cardiovascular diseases in children and adolescents with type 1 diabetes |
| url | http://dx.doi.org/10.1155/2021/5555149 |
| work_keys_str_mv | AT katarzynanoras theproblemofabnormalbodyweightanddyslipidemiaasriskfactorsforcardiovasculardiseasesinchildrenandadolescentswithtype1diabetes AT ewarusak theproblemofabnormalbodyweightanddyslipidemiaasriskfactorsforcardiovasculardiseasesinchildrenandadolescentswithtype1diabetes AT przemysławajaroszchobot theproblemofabnormalbodyweightanddyslipidemiaasriskfactorsforcardiovasculardiseasesinchildrenandadolescentswithtype1diabetes AT katarzynanoras problemofabnormalbodyweightanddyslipidemiaasriskfactorsforcardiovasculardiseasesinchildrenandadolescentswithtype1diabetes AT ewarusak problemofabnormalbodyweightanddyslipidemiaasriskfactorsforcardiovasculardiseasesinchildrenandadolescentswithtype1diabetes AT przemysławajaroszchobot problemofabnormalbodyweightanddyslipidemiaasriskfactorsforcardiovasculardiseasesinchildrenandadolescentswithtype1diabetes |