Optimal dietary vitamin E level facilitates ovarian development of female largemouth bass (Micropterus salmoides) broodstock
The current study was designed to explore the effects of dietary vitamin E on the ovarian development and health of female largemouth bass (Micropterus salmoides). Five experimental diets were formulated, each containing varying concentrations of vitamin E: 78.25, 98.36, 209.31, 437.77, and 915.49 m...
Saved in:
| Main Authors: | , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Elsevier
2025-04-01
|
| Series: | Aquaculture Reports |
| Subjects: | |
| Online Access: | http://www.sciencedirect.com/science/article/pii/S2352513425000493 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1832557533261201408 |
|---|---|
| author | Qiuyu Gao Qiao Feng Dong Zhou Zhili Ding Changle Qi Youqin Kong Qiyou Xu |
| author_facet | Qiuyu Gao Qiao Feng Dong Zhou Zhili Ding Changle Qi Youqin Kong Qiyou Xu |
| author_sort | Qiuyu Gao |
| collection | DOAJ |
| description | The current study was designed to explore the effects of dietary vitamin E on the ovarian development and health of female largemouth bass (Micropterus salmoides). Five experimental diets were formulated, each containing varying concentrations of vitamin E: 78.25, 98.36, 209.31, 437.77, and 915.49 mg/kg of vitamin E. These diets were administered to female largemouth bass (445.52 ± 13.57 g) for 35 days. The results demonstrated that fishes fed with 209.31 mg/kg vitamin E exhibited a significantly higher gonadosomatic index (GSI), visceral steatosis index, absolute fecundity, and relative fecundity compared to those fed with 78.25 mg/kg of vitamin E (P < 0.05). Meanwhile, it was observed that a predominant number of ovarian cells in fish fed 209.31 and 437.77 mg/kg of vitamin E had advanced to maturation, primarily consisting of mature oocytes at stage IV and V. Dietary vitamin E supplementation significantly upregulated the expression of genes involving vitamin E transfer, ovarian development, and hormone, including alpha-tocopherol transfer protein, luteinizing hormone, follicle-stimulating hormone, vitellogenin receptor (vgr), vitellogenin (vg), 17-beta-hydroxysteroid dehydrogenase (17β-hsd), cyclin-dependent kinase 2 (cdk2), and cytochrome P450 family 17 (cyp-17), with the highest expression levels detected in the 209.31 mg/kg group (P < 0.05). Additionally, 209.31 mg/kg of vitamin E also significantly increasing the immunity by reducing the activities of glutamic oxaloacetic transaminase and glutamic pyruvic transaminase in the serum, while increased the activities of alkaline phosphatase and acid phosphatase when compared to the 78.25 and 915.49 mg/kg groups (P < 0.05). 209.31 and 437.77 mg/kg of vitamin E significantly enhanced the antioxidant capacity of fish (P < 0.05). The optimal dietary vitamin E requirement was determined as 255.10–292.72 mg/kg based on GSI, absolute fecundity, and the expression levels of vg and vgr. In conclusion, the addition of 255.10 292.72 mg/kg of vitamin E to the diet of largemouth bass broodstock is recommend to enhance ovarian development. |
| format | Article |
| id | doaj-art-9b6785bb58434d0dbbfdf4736869b9de |
| institution | Kabale University |
| issn | 2352-5134 |
| language | English |
| publishDate | 2025-04-01 |
| publisher | Elsevier |
| record_format | Article |
| series | Aquaculture Reports |
| spelling | doaj-art-9b6785bb58434d0dbbfdf4736869b9de2025-02-03T04:16:45ZengElsevierAquaculture Reports2352-51342025-04-0141102663Optimal dietary vitamin E level facilitates ovarian development of female largemouth bass (Micropterus salmoides) broodstockQiuyu Gao0Qiao Feng1Dong Zhou2Zhili Ding3Changle Qi4Youqin Kong5Qiyou Xu6National-Local Joint Engineering Laboratory of Aquatic Animal Genetic Breeding and Nutrition, Zhejiang Provincial Key Laboratory of Aquatic Resources Conservation and Development, College of Life Science, Huzhou University, Huzhou, Zhejiang 313000, ChinaNational-Local Joint Engineering Laboratory of Aquatic Animal Genetic Breeding and Nutrition, Zhejiang Provincial Key Laboratory of Aquatic Resources Conservation and Development, College of Life Science, Huzhou University, Huzhou, Zhejiang 313000, ChinaNational-Local Joint Engineering Laboratory of Aquatic Animal Genetic Breeding and Nutrition, Zhejiang Provincial Key Laboratory of Aquatic Resources Conservation and Development, College of Life Science, Huzhou University, Huzhou, Zhejiang 313000, ChinaNational-Local Joint Engineering Laboratory of Aquatic Animal Genetic Breeding and Nutrition, Zhejiang Provincial Key Laboratory of Aquatic Resources Conservation and Development, College of Life Science, Huzhou University, Huzhou, Zhejiang 313000, ChinaNational-Local Joint Engineering Laboratory of Aquatic Animal Genetic Breeding and Nutrition, Zhejiang Provincial Key Laboratory of Aquatic Resources Conservation and Development, College of Life Science, Huzhou University, Huzhou, Zhejiang 313000, ChinaCorresponding authors.; National-Local Joint Engineering Laboratory of Aquatic Animal Genetic Breeding and Nutrition, Zhejiang Provincial Key Laboratory of Aquatic Resources Conservation and Development, College of Life Science, Huzhou University, Huzhou, Zhejiang 313000, ChinaCorresponding authors.; National-Local Joint Engineering Laboratory of Aquatic Animal Genetic Breeding and Nutrition, Zhejiang Provincial Key Laboratory of Aquatic Resources Conservation and Development, College of Life Science, Huzhou University, Huzhou, Zhejiang 313000, ChinaThe current study was designed to explore the effects of dietary vitamin E on the ovarian development and health of female largemouth bass (Micropterus salmoides). Five experimental diets were formulated, each containing varying concentrations of vitamin E: 78.25, 98.36, 209.31, 437.77, and 915.49 mg/kg of vitamin E. These diets were administered to female largemouth bass (445.52 ± 13.57 g) for 35 days. The results demonstrated that fishes fed with 209.31 mg/kg vitamin E exhibited a significantly higher gonadosomatic index (GSI), visceral steatosis index, absolute fecundity, and relative fecundity compared to those fed with 78.25 mg/kg of vitamin E (P < 0.05). Meanwhile, it was observed that a predominant number of ovarian cells in fish fed 209.31 and 437.77 mg/kg of vitamin E had advanced to maturation, primarily consisting of mature oocytes at stage IV and V. Dietary vitamin E supplementation significantly upregulated the expression of genes involving vitamin E transfer, ovarian development, and hormone, including alpha-tocopherol transfer protein, luteinizing hormone, follicle-stimulating hormone, vitellogenin receptor (vgr), vitellogenin (vg), 17-beta-hydroxysteroid dehydrogenase (17β-hsd), cyclin-dependent kinase 2 (cdk2), and cytochrome P450 family 17 (cyp-17), with the highest expression levels detected in the 209.31 mg/kg group (P < 0.05). Additionally, 209.31 mg/kg of vitamin E also significantly increasing the immunity by reducing the activities of glutamic oxaloacetic transaminase and glutamic pyruvic transaminase in the serum, while increased the activities of alkaline phosphatase and acid phosphatase when compared to the 78.25 and 915.49 mg/kg groups (P < 0.05). 209.31 and 437.77 mg/kg of vitamin E significantly enhanced the antioxidant capacity of fish (P < 0.05). The optimal dietary vitamin E requirement was determined as 255.10–292.72 mg/kg based on GSI, absolute fecundity, and the expression levels of vg and vgr. In conclusion, the addition of 255.10 292.72 mg/kg of vitamin E to the diet of largemouth bass broodstock is recommend to enhance ovarian development.http://www.sciencedirect.com/science/article/pii/S2352513425000493Vitamin EMicropterus salmoidesBroodstockOvarian developmentImmunity |
| spellingShingle | Qiuyu Gao Qiao Feng Dong Zhou Zhili Ding Changle Qi Youqin Kong Qiyou Xu Optimal dietary vitamin E level facilitates ovarian development of female largemouth bass (Micropterus salmoides) broodstock Aquaculture Reports Vitamin E Micropterus salmoides Broodstock Ovarian development Immunity |
| title | Optimal dietary vitamin E level facilitates ovarian development of female largemouth bass (Micropterus salmoides) broodstock |
| title_full | Optimal dietary vitamin E level facilitates ovarian development of female largemouth bass (Micropterus salmoides) broodstock |
| title_fullStr | Optimal dietary vitamin E level facilitates ovarian development of female largemouth bass (Micropterus salmoides) broodstock |
| title_full_unstemmed | Optimal dietary vitamin E level facilitates ovarian development of female largemouth bass (Micropterus salmoides) broodstock |
| title_short | Optimal dietary vitamin E level facilitates ovarian development of female largemouth bass (Micropterus salmoides) broodstock |
| title_sort | optimal dietary vitamin e level facilitates ovarian development of female largemouth bass micropterus salmoides broodstock |
| topic | Vitamin E Micropterus salmoides Broodstock Ovarian development Immunity |
| url | http://www.sciencedirect.com/science/article/pii/S2352513425000493 |
| work_keys_str_mv | AT qiuyugao optimaldietaryvitaminelevelfacilitatesovariandevelopmentoffemalelargemouthbassmicropterussalmoidesbroodstock AT qiaofeng optimaldietaryvitaminelevelfacilitatesovariandevelopmentoffemalelargemouthbassmicropterussalmoidesbroodstock AT dongzhou optimaldietaryvitaminelevelfacilitatesovariandevelopmentoffemalelargemouthbassmicropterussalmoidesbroodstock AT zhiliding optimaldietaryvitaminelevelfacilitatesovariandevelopmentoffemalelargemouthbassmicropterussalmoidesbroodstock AT changleqi optimaldietaryvitaminelevelfacilitatesovariandevelopmentoffemalelargemouthbassmicropterussalmoidesbroodstock AT youqinkong optimaldietaryvitaminelevelfacilitatesovariandevelopmentoffemalelargemouthbassmicropterussalmoidesbroodstock AT qiyouxu optimaldietaryvitaminelevelfacilitatesovariandevelopmentoffemalelargemouthbassmicropterussalmoidesbroodstock |