Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis

A 34-year-old female presented with recurrent ulcers over the bilateral lower limbs with mononeuritis multiplex. Possibilities considered were small-to-medium vessel vasculitis and vasculopathy. Skin biopsy was suggestive of livedoid vasculopathy (LV). Investigations revealed protein S deficiency. T...

Full description

Saved in:
Bibliographic Details
Main Authors: Vikramraj K Jain, Krishnamurthy Hegde, Renuka Panchagnula
Format: Article
Language:English
Published: SAGE Publishing 2019-01-01
Series:Indian Journal of Rheumatology
Subjects:
Online Access:http://www.indianjrheumatol.com/article.asp?issn=0973-3698;year=2019;volume=14;issue=1;spage=69;epage=73;aulast=Jain
Tags: Add Tag
No Tags, Be the first to tag this record!
_version_ 1832569127144783872
author Vikramraj K Jain
Krishnamurthy Hegde
Renuka Panchagnula
author_facet Vikramraj K Jain
Krishnamurthy Hegde
Renuka Panchagnula
author_sort Vikramraj K Jain
collection DOAJ
description A 34-year-old female presented with recurrent ulcers over the bilateral lower limbs with mononeuritis multiplex. Possibilities considered were small-to-medium vessel vasculitis and vasculopathy. Skin biopsy was suggestive of livedoid vasculopathy (LV). Investigations revealed protein S deficiency. The patient was treated with anticoagulation and immunosuppression after which her symptoms improved. LV can be associated with thrombophilias, fibrinolytic disorders, autoimmune diseases, and malignancy. Polyarteritis nodosa closely mimics the disease and needs a deep dermal biopsy to differentiate.
format Article
id doaj-art-75a2e0fa68c245bc9c75352e82ba3638
institution Kabale University
issn 0973-3698
0973-3701
language English
publishDate 2019-01-01
publisher SAGE Publishing
record_format Article
series Indian Journal of Rheumatology
spelling doaj-art-75a2e0fa68c245bc9c75352e82ba36382025-02-02T23:16:29ZengSAGE PublishingIndian Journal of Rheumatology0973-36980973-37012019-01-01141697310.4103/injr.injr_97_18Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitisVikramraj K JainKrishnamurthy HegdeRenuka PanchagnulaA 34-year-old female presented with recurrent ulcers over the bilateral lower limbs with mononeuritis multiplex. Possibilities considered were small-to-medium vessel vasculitis and vasculopathy. Skin biopsy was suggestive of livedoid vasculopathy (LV). Investigations revealed protein S deficiency. The patient was treated with anticoagulation and immunosuppression after which her symptoms improved. LV can be associated with thrombophilias, fibrinolytic disorders, autoimmune diseases, and malignancy. Polyarteritis nodosa closely mimics the disease and needs a deep dermal biopsy to differentiate.http://www.indianjrheumatol.com/article.asp?issn=0973-3698;year=2019;volume=14;issue=1;spage=69;epage=73;aulast=JainLivedoidpolyarteritis nodosaprotein S deficiencyvasculopathy
spellingShingle Vikramraj K Jain
Krishnamurthy Hegde
Renuka Panchagnula
Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis
Indian Journal of Rheumatology
Livedoid
polyarteritis nodosa
protein S deficiency
vasculopathy
title Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis
title_full Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis
title_fullStr Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis
title_full_unstemmed Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis
title_short Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis
title_sort livedoid vasculopathy with mononeuritis multiplex associated with protein s deficiency mimicking systemic vasculitis
topic Livedoid
polyarteritis nodosa
protein S deficiency
vasculopathy
url http://www.indianjrheumatol.com/article.asp?issn=0973-3698;year=2019;volume=14;issue=1;spage=69;epage=73;aulast=Jain
work_keys_str_mv AT vikramrajkjain livedoidvasculopathywithmononeuritismultiplexassociatedwithproteinsdeficiencymimickingsystemicvasculitis
AT krishnamurthyhegde livedoidvasculopathywithmononeuritismultiplexassociatedwithproteinsdeficiencymimickingsystemicvasculitis
AT renukapanchagnula livedoidvasculopathywithmononeuritismultiplexassociatedwithproteinsdeficiencymimickingsystemicvasculitis