Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis
A 34-year-old female presented with recurrent ulcers over the bilateral lower limbs with mononeuritis multiplex. Possibilities considered were small-to-medium vessel vasculitis and vasculopathy. Skin biopsy was suggestive of livedoid vasculopathy (LV). Investigations revealed protein S deficiency. T...
Saved in:
Main Authors: | , , |
---|---|
Format: | Article |
Language: | English |
Published: |
SAGE Publishing
2019-01-01
|
Series: | Indian Journal of Rheumatology |
Subjects: | |
Online Access: | http://www.indianjrheumatol.com/article.asp?issn=0973-3698;year=2019;volume=14;issue=1;spage=69;epage=73;aulast=Jain |
Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
_version_ | 1832569127144783872 |
---|---|
author | Vikramraj K Jain Krishnamurthy Hegde Renuka Panchagnula |
author_facet | Vikramraj K Jain Krishnamurthy Hegde Renuka Panchagnula |
author_sort | Vikramraj K Jain |
collection | DOAJ |
description | A 34-year-old female presented with recurrent ulcers over the bilateral lower limbs with mononeuritis multiplex. Possibilities considered were small-to-medium vessel vasculitis and vasculopathy. Skin biopsy was suggestive of livedoid vasculopathy (LV). Investigations revealed protein S deficiency. The patient was treated with anticoagulation and immunosuppression after which her symptoms improved. LV can be associated with thrombophilias, fibrinolytic disorders, autoimmune diseases, and malignancy. Polyarteritis nodosa closely mimics the disease and needs a deep dermal biopsy to differentiate. |
format | Article |
id | doaj-art-75a2e0fa68c245bc9c75352e82ba3638 |
institution | Kabale University |
issn | 0973-3698 0973-3701 |
language | English |
publishDate | 2019-01-01 |
publisher | SAGE Publishing |
record_format | Article |
series | Indian Journal of Rheumatology |
spelling | doaj-art-75a2e0fa68c245bc9c75352e82ba36382025-02-02T23:16:29ZengSAGE PublishingIndian Journal of Rheumatology0973-36980973-37012019-01-01141697310.4103/injr.injr_97_18Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitisVikramraj K JainKrishnamurthy HegdeRenuka PanchagnulaA 34-year-old female presented with recurrent ulcers over the bilateral lower limbs with mononeuritis multiplex. Possibilities considered were small-to-medium vessel vasculitis and vasculopathy. Skin biopsy was suggestive of livedoid vasculopathy (LV). Investigations revealed protein S deficiency. The patient was treated with anticoagulation and immunosuppression after which her symptoms improved. LV can be associated with thrombophilias, fibrinolytic disorders, autoimmune diseases, and malignancy. Polyarteritis nodosa closely mimics the disease and needs a deep dermal biopsy to differentiate.http://www.indianjrheumatol.com/article.asp?issn=0973-3698;year=2019;volume=14;issue=1;spage=69;epage=73;aulast=JainLivedoidpolyarteritis nodosaprotein S deficiencyvasculopathy |
spellingShingle | Vikramraj K Jain Krishnamurthy Hegde Renuka Panchagnula Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis Indian Journal of Rheumatology Livedoid polyarteritis nodosa protein S deficiency vasculopathy |
title | Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis |
title_full | Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis |
title_fullStr | Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis |
title_full_unstemmed | Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis |
title_short | Livedoid vasculopathy with mononeuritis multiplex associated with protein S deficiency mimicking systemic vasculitis |
title_sort | livedoid vasculopathy with mononeuritis multiplex associated with protein s deficiency mimicking systemic vasculitis |
topic | Livedoid polyarteritis nodosa protein S deficiency vasculopathy |
url | http://www.indianjrheumatol.com/article.asp?issn=0973-3698;year=2019;volume=14;issue=1;spage=69;epage=73;aulast=Jain |
work_keys_str_mv | AT vikramrajkjain livedoidvasculopathywithmononeuritismultiplexassociatedwithproteinsdeficiencymimickingsystemicvasculitis AT krishnamurthyhegde livedoidvasculopathywithmononeuritismultiplexassociatedwithproteinsdeficiencymimickingsystemicvasculitis AT renukapanchagnula livedoidvasculopathywithmononeuritismultiplexassociatedwithproteinsdeficiencymimickingsystemicvasculitis |