A TAT Peptide-Functionalized Liposome Delivery Phage System (TAT-Lip@PHM) for an Enhanced Eradication of Intracellular MRSA
<b>Background:</b> Intracellular bacteria frequently result in chronic and recurrent infections. MRSA is one of the most prevalent facultative intracellular bacteria in clinical infections. The drug resistance of MRSA and the difficulty of most antibiotics in entering cells result in a s...
Saved in:
| Main Authors: | , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
MDPI AG
2025-06-01
|
| Series: | Pharmaceutics |
| Subjects: | |
| Online Access: | https://www.mdpi.com/1999-4923/17/6/743 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1850164777039429632 |
|---|---|
| author | Kaixin Liu Xin Lu Xudong Guo Yi Yang Wanying Liu Hongbin Song Rongtao Zhao |
| author_facet | Kaixin Liu Xin Lu Xudong Guo Yi Yang Wanying Liu Hongbin Song Rongtao Zhao |
| author_sort | Kaixin Liu |
| collection | DOAJ |
| description | <b>Background:</b> Intracellular bacteria frequently result in chronic and recurrent infections. MRSA is one of the most prevalent facultative intracellular bacteria in clinical infections. The drug resistance of MRSA and the difficulty of most antibiotics in entering cells result in a suboptimal clinical efficacy of antibiotics in the treatment of intracellular MRSA. Bacteriophages represent a promising alternative therapy in the context of the current antimicrobial resistance crisis. Nevertheless, the low efficiency of phage entry into cells and their rapid inactivation remain challenges in the treatment of intracellular MRSA using phages. The utilization of functionalized carriers for the delivery of phages into cells and their protection represents a feasible strategy. <b>Methods:</b> In this study, a new MRSA bacteriophage (vB_SauS_PHM) was isolated from hospital sewage, exhibiting the characteristics of short incubation period, large lytic amount, and good environmental tolerance. Subsequently, vB_SauS_PHM was encapsulated by TAT peptide-functionalized liposomes through microfluidic technology and size-exclusion chromatography (SEC), forming a phage delivery system, designated TAT-Lip@PHM. <b>Results:</b> The encapsulation rate of the phage by TAT-Lip@PHM was 20.3%, and the cell entry efficiency was ≥90% after 8 h. The 24 h eradication rate of 300 μg/mL TAT-Lip@PHM against intracellular MRSA was 94.05% (superior to the 21.24% and 44.90% of vB_SauS_PHM and Lip@PHM, respectively), while the mammalian cell activity was >85% after 24 h incubation. <b>Conclusions:</b> The TAT-Lip@PHM effectively delivered the phage into the cell and showed an excellent killing effect on intracellular MRSA with low cytotoxicity. This work provides a technical reference for the application of phages in the treatment of intracellular bacterial infection. |
| format | Article |
| id | doaj-art-541699ac1c254a27af738c43d8088be7 |
| institution | OA Journals |
| issn | 1999-4923 |
| language | English |
| publishDate | 2025-06-01 |
| publisher | MDPI AG |
| record_format | Article |
| series | Pharmaceutics |
| spelling | doaj-art-541699ac1c254a27af738c43d8088be72025-08-20T02:21:53ZengMDPI AGPharmaceutics1999-49232025-06-0117674310.3390/pharmaceutics17060743A TAT Peptide-Functionalized Liposome Delivery Phage System (TAT-Lip@PHM) for an Enhanced Eradication of Intracellular MRSAKaixin Liu0Xin Lu1Xudong Guo2Yi Yang3Wanying Liu4Hongbin Song5Rongtao Zhao6Chinese PLA Center for Disease Control and Prevention, Beijing 100071, ChinaThe Fifth Medical Center of Chinese PLA General Hospital, Beijing 100071, ChinaChinese PLA Center for Disease Control and Prevention, Beijing 100071, ChinaChinese PLA Center for Disease Control and Prevention, Beijing 100071, ChinaChinese PLA Center for Disease Control and Prevention, Beijing 100071, ChinaChinese PLA Center for Disease Control and Prevention, Beijing 100071, ChinaChinese PLA Center for Disease Control and Prevention, Beijing 100071, China<b>Background:</b> Intracellular bacteria frequently result in chronic and recurrent infections. MRSA is one of the most prevalent facultative intracellular bacteria in clinical infections. The drug resistance of MRSA and the difficulty of most antibiotics in entering cells result in a suboptimal clinical efficacy of antibiotics in the treatment of intracellular MRSA. Bacteriophages represent a promising alternative therapy in the context of the current antimicrobial resistance crisis. Nevertheless, the low efficiency of phage entry into cells and their rapid inactivation remain challenges in the treatment of intracellular MRSA using phages. The utilization of functionalized carriers for the delivery of phages into cells and their protection represents a feasible strategy. <b>Methods:</b> In this study, a new MRSA bacteriophage (vB_SauS_PHM) was isolated from hospital sewage, exhibiting the characteristics of short incubation period, large lytic amount, and good environmental tolerance. Subsequently, vB_SauS_PHM was encapsulated by TAT peptide-functionalized liposomes through microfluidic technology and size-exclusion chromatography (SEC), forming a phage delivery system, designated TAT-Lip@PHM. <b>Results:</b> The encapsulation rate of the phage by TAT-Lip@PHM was 20.3%, and the cell entry efficiency was ≥90% after 8 h. The 24 h eradication rate of 300 μg/mL TAT-Lip@PHM against intracellular MRSA was 94.05% (superior to the 21.24% and 44.90% of vB_SauS_PHM and Lip@PHM, respectively), while the mammalian cell activity was >85% after 24 h incubation. <b>Conclusions:</b> The TAT-Lip@PHM effectively delivered the phage into the cell and showed an excellent killing effect on intracellular MRSA with low cytotoxicity. This work provides a technical reference for the application of phages in the treatment of intracellular bacterial infection.https://www.mdpi.com/1999-4923/17/6/743intracellular MRSAphage deliveryTAT peptideliposome |
| spellingShingle | Kaixin Liu Xin Lu Xudong Guo Yi Yang Wanying Liu Hongbin Song Rongtao Zhao A TAT Peptide-Functionalized Liposome Delivery Phage System (TAT-Lip@PHM) for an Enhanced Eradication of Intracellular MRSA Pharmaceutics intracellular MRSA phage delivery TAT peptide liposome |
| title | A TAT Peptide-Functionalized Liposome Delivery Phage System (TAT-Lip@PHM) for an Enhanced Eradication of Intracellular MRSA |
| title_full | A TAT Peptide-Functionalized Liposome Delivery Phage System (TAT-Lip@PHM) for an Enhanced Eradication of Intracellular MRSA |
| title_fullStr | A TAT Peptide-Functionalized Liposome Delivery Phage System (TAT-Lip@PHM) for an Enhanced Eradication of Intracellular MRSA |
| title_full_unstemmed | A TAT Peptide-Functionalized Liposome Delivery Phage System (TAT-Lip@PHM) for an Enhanced Eradication of Intracellular MRSA |
| title_short | A TAT Peptide-Functionalized Liposome Delivery Phage System (TAT-Lip@PHM) for an Enhanced Eradication of Intracellular MRSA |
| title_sort | tat peptide functionalized liposome delivery phage system tat lip phm for an enhanced eradication of intracellular mrsa |
| topic | intracellular MRSA phage delivery TAT peptide liposome |
| url | https://www.mdpi.com/1999-4923/17/6/743 |
| work_keys_str_mv | AT kaixinliu atatpeptidefunctionalizedliposomedeliveryphagesystemtatlipphmforanenhancederadicationofintracellularmrsa AT xinlu atatpeptidefunctionalizedliposomedeliveryphagesystemtatlipphmforanenhancederadicationofintracellularmrsa AT xudongguo atatpeptidefunctionalizedliposomedeliveryphagesystemtatlipphmforanenhancederadicationofintracellularmrsa AT yiyang atatpeptidefunctionalizedliposomedeliveryphagesystemtatlipphmforanenhancederadicationofintracellularmrsa AT wanyingliu atatpeptidefunctionalizedliposomedeliveryphagesystemtatlipphmforanenhancederadicationofintracellularmrsa AT hongbinsong atatpeptidefunctionalizedliposomedeliveryphagesystemtatlipphmforanenhancederadicationofintracellularmrsa AT rongtaozhao atatpeptidefunctionalizedliposomedeliveryphagesystemtatlipphmforanenhancederadicationofintracellularmrsa AT kaixinliu tatpeptidefunctionalizedliposomedeliveryphagesystemtatlipphmforanenhancederadicationofintracellularmrsa AT xinlu tatpeptidefunctionalizedliposomedeliveryphagesystemtatlipphmforanenhancederadicationofintracellularmrsa AT xudongguo tatpeptidefunctionalizedliposomedeliveryphagesystemtatlipphmforanenhancederadicationofintracellularmrsa AT yiyang tatpeptidefunctionalizedliposomedeliveryphagesystemtatlipphmforanenhancederadicationofintracellularmrsa AT wanyingliu tatpeptidefunctionalizedliposomedeliveryphagesystemtatlipphmforanenhancederadicationofintracellularmrsa AT hongbinsong tatpeptidefunctionalizedliposomedeliveryphagesystemtatlipphmforanenhancederadicationofintracellularmrsa AT rongtaozhao tatpeptidefunctionalizedliposomedeliveryphagesystemtatlipphmforanenhancederadicationofintracellularmrsa |