Cardiometabolic Risk in Hyperlipidemic Men and Women
Objective. The aim of this study was to evaluate sex specific differences of metabolic and clinical characteristics of treated hyperlipidemic men and women (HL-men and HL-women). Methods. In this study vascular and metabolic characteristics of 35 HL-women and 64 HL-men were assessed. In addition a s...
Saved in:
| Main Authors: | , , , , , , , , , , |
|---|---|
| Format: | Article |
| Language: | English |
| Published: |
Wiley
2016-01-01
|
| Series: | International Journal of Endocrinology |
| Online Access: | http://dx.doi.org/10.1155/2016/2647865 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| _version_ | 1832548113745707008 |
|---|---|
| author | Michael Leutner Christian Göbl Alice Wielandner Eleonora Howorka Marlies Prünner Latife Bozkurt Jürgen Harreiter Helmut Prosch Oliver Schlager Silvia Charwat-Resl Alexandra Kautzky-Willer |
| author_facet | Michael Leutner Christian Göbl Alice Wielandner Eleonora Howorka Marlies Prünner Latife Bozkurt Jürgen Harreiter Helmut Prosch Oliver Schlager Silvia Charwat-Resl Alexandra Kautzky-Willer |
| author_sort | Michael Leutner |
| collection | DOAJ |
| description | Objective. The aim of this study was to evaluate sex specific differences of metabolic and clinical characteristics of treated hyperlipidemic men and women (HL-men and HL-women). Methods. In this study vascular and metabolic characteristics of 35 HL-women and 64 HL-men were assessed. In addition a sex specific analysis of metabolic and nutritional habits of HL-patients with prediabetes (HL-IGR) was done. Results. HL-women were older and had favourable concentrations of high density lipoprotein cholesterol (HDL-cholesterol), triglycerides (TG), and triglyceride/HDL-cholesterol ratio (TG/HDL-ratio) but were also shown to have higher concentrations of lipoprotein-a compared to HL-men. HL-men were characterized as having higher levels of liver-specific parameters and body weight as well as being more physically active compared to HL-women. Brain natriuretic peptide (pro-BNP) was higher in HL-women than HL-men, while no differences in metabolic syndrome and glycemic parameters were shown. HL-IGR-women were also older and still had a better profile of sex specific lipid parameters, as well as a lower body weight compared to HL-IGR-men. No differences were seen in vascular parameters such as the intima media thickness (IMT). Conclusion. HL-women were older and had overall more favourable concentrations of lipid parameters and liver enzymes but did not differ regarding vascular morphology and insulin sensitivity compared to HL-men of comparable body mass index (BMI). |
| format | Article |
| id | doaj-art-4c0331cf6a544791aeb8de4c2a842ac7 |
| institution | Kabale University |
| issn | 1687-8337 1687-8345 |
| language | English |
| publishDate | 2016-01-01 |
| publisher | Wiley |
| record_format | Article |
| series | International Journal of Endocrinology |
| spelling | doaj-art-4c0331cf6a544791aeb8de4c2a842ac72025-02-03T06:42:07ZengWileyInternational Journal of Endocrinology1687-83371687-83452016-01-01201610.1155/2016/26478652647865Cardiometabolic Risk in Hyperlipidemic Men and WomenMichael Leutner0Christian Göbl1Alice Wielandner2Eleonora Howorka3Marlies Prünner4Latife Bozkurt5Jürgen Harreiter6Helmut Prosch7Oliver Schlager8Silvia Charwat-Resl9Alexandra Kautzky-Willer10Department of Internal Medicine III, Division of Endocrinology and Metabolism, Unit of Gender Medicine, Medical University of Vienna, Waehringer Guertel 18-20, 1090 Vienna, AustriaDepartment of Gynecology and Obstetrics, Division of Feto-Maternal Medicine, Medical University of Vienna, Waehringer Guertel 18-20, 1090 Vienna, AustriaDepartment of Biomedical Imaging and Image Guided Therapy, Medical University of Vienna, Waehringer Guertel 18-20, 1090 Vienna, AustriaDepartment of Internal Medicine III, Division of Endocrinology and Metabolism, Unit of Gender Medicine, Medical University of Vienna, Waehringer Guertel 18-20, 1090 Vienna, AustriaDepartment of Internal Medicine III, Division of Endocrinology and Metabolism, Unit of Gender Medicine, Medical University of Vienna, Waehringer Guertel 18-20, 1090 Vienna, AustriaDepartment of Internal Medicine III, Clinical Division of Endocrinology and Metabolism, Medical University of Vienna, Waehringer Giertel 18-20, 1090 Vienna, AustriaDepartment of Internal Medicine III, Division of Endocrinology and Metabolism, Unit of Gender Medicine, Medical University of Vienna, Waehringer Guertel 18-20, 1090 Vienna, AustriaDepartment of Biomedical Imaging and Image Guided Therapy, Medical University of Vienna, Waehringer Guertel 18-20, 1090 Vienna, AustriaDepartment of Internal Medicine II, Division of Angiology, Medical University of Vienna, Waehringer Guertel 18-20, 1090 Vienna, AustriaDepartment of Internal Medicine II, Division of Angiology, Medical University of Vienna, Waehringer Guertel 18-20, 1090 Vienna, AustriaDepartment of Internal Medicine III, Division of Endocrinology and Metabolism, Unit of Gender Medicine, Medical University of Vienna, Waehringer Guertel 18-20, 1090 Vienna, AustriaObjective. The aim of this study was to evaluate sex specific differences of metabolic and clinical characteristics of treated hyperlipidemic men and women (HL-men and HL-women). Methods. In this study vascular and metabolic characteristics of 35 HL-women and 64 HL-men were assessed. In addition a sex specific analysis of metabolic and nutritional habits of HL-patients with prediabetes (HL-IGR) was done. Results. HL-women were older and had favourable concentrations of high density lipoprotein cholesterol (HDL-cholesterol), triglycerides (TG), and triglyceride/HDL-cholesterol ratio (TG/HDL-ratio) but were also shown to have higher concentrations of lipoprotein-a compared to HL-men. HL-men were characterized as having higher levels of liver-specific parameters and body weight as well as being more physically active compared to HL-women. Brain natriuretic peptide (pro-BNP) was higher in HL-women than HL-men, while no differences in metabolic syndrome and glycemic parameters were shown. HL-IGR-women were also older and still had a better profile of sex specific lipid parameters, as well as a lower body weight compared to HL-IGR-men. No differences were seen in vascular parameters such as the intima media thickness (IMT). Conclusion. HL-women were older and had overall more favourable concentrations of lipid parameters and liver enzymes but did not differ regarding vascular morphology and insulin sensitivity compared to HL-men of comparable body mass index (BMI).http://dx.doi.org/10.1155/2016/2647865 |
| spellingShingle | Michael Leutner Christian Göbl Alice Wielandner Eleonora Howorka Marlies Prünner Latife Bozkurt Jürgen Harreiter Helmut Prosch Oliver Schlager Silvia Charwat-Resl Alexandra Kautzky-Willer Cardiometabolic Risk in Hyperlipidemic Men and Women International Journal of Endocrinology |
| title | Cardiometabolic Risk in Hyperlipidemic Men and Women |
| title_full | Cardiometabolic Risk in Hyperlipidemic Men and Women |
| title_fullStr | Cardiometabolic Risk in Hyperlipidemic Men and Women |
| title_full_unstemmed | Cardiometabolic Risk in Hyperlipidemic Men and Women |
| title_short | Cardiometabolic Risk in Hyperlipidemic Men and Women |
| title_sort | cardiometabolic risk in hyperlipidemic men and women |
| url | http://dx.doi.org/10.1155/2016/2647865 |
| work_keys_str_mv | AT michaelleutner cardiometabolicriskinhyperlipidemicmenandwomen AT christiangobl cardiometabolicriskinhyperlipidemicmenandwomen AT alicewielandner cardiometabolicriskinhyperlipidemicmenandwomen AT eleonorahoworka cardiometabolicriskinhyperlipidemicmenandwomen AT marliesprunner cardiometabolicriskinhyperlipidemicmenandwomen AT latifebozkurt cardiometabolicriskinhyperlipidemicmenandwomen AT jurgenharreiter cardiometabolicriskinhyperlipidemicmenandwomen AT helmutprosch cardiometabolicriskinhyperlipidemicmenandwomen AT oliverschlager cardiometabolicriskinhyperlipidemicmenandwomen AT silviacharwatresl cardiometabolicriskinhyperlipidemicmenandwomen AT alexandrakautzkywiller cardiometabolicriskinhyperlipidemicmenandwomen |