The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells
Thiazolidinediones (TZDs) dramatically reduce the growth of human prostate cancer cells in vitro and in vivo. To determine whether the antitumor effects of TZDs were due in part to changes in the MEK/Erk signaling pathway, we examined the regulation of Erk phosphorylation by the TZD troglitazone wit...
Saved in:
Main Authors: | , , , , |
---|---|
Format: | Article |
Language: | English |
Published: |
Wiley
2012-01-01
|
Series: | PPAR Research |
Online Access: | http://dx.doi.org/10.1155/2012/929052 |
Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
_version_ | 1832548317314154496 |
---|---|
author | Adrienne Bolden Lynikka Bernard Danielle Jones Tunde Akinyeke LaMonica V. Stewart |
author_facet | Adrienne Bolden Lynikka Bernard Danielle Jones Tunde Akinyeke LaMonica V. Stewart |
author_sort | Adrienne Bolden |
collection | DOAJ |
description | Thiazolidinediones (TZDs) dramatically reduce the growth of human prostate cancer cells in vitro and in vivo. To determine whether the antitumor effects of TZDs were due in part to changes in the MEK/Erk signaling pathway, we examined the regulation of Erk phosphorylation by the TZD troglitazone within the PC-3 and C4-2 human prostate cancer cell lines. Western blot analysis revealed troglitazone-induced phosphorylation of Erk in both PC-3 and C4-2 cells. Troglitazone-induced increases in Erk phosphorylation were suppressed by the MEK inhibitor U0126 but not by the PPARγ antagonist GW9662. Pretreatment with U0126 did not alter the ability of troglitazone to regulate expression of two proteins that control cell cycle, p21, and c-Myc. Troglitazone was also still effective at reducing PC-3 proliferation in the presence of U0126. Therefore, our data suggest that troglitazone-induced Erk phosphorylation does not significantly contribute to the antiproliferative effect of troglitazone. |
format | Article |
id | doaj-art-2fcd54810502460bbfb52ba44e109896 |
institution | Kabale University |
issn | 1687-4757 1687-4765 |
language | English |
publishDate | 2012-01-01 |
publisher | Wiley |
record_format | Article |
series | PPAR Research |
spelling | doaj-art-2fcd54810502460bbfb52ba44e1098962025-02-03T06:14:19ZengWileyPPAR Research1687-47571687-47652012-01-01201210.1155/2012/929052929052The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer CellsAdrienne Bolden0Lynikka Bernard1Danielle Jones2Tunde Akinyeke3LaMonica V. Stewart4Department of Biochemistry and Cancer Biology, Meharry Medical College, Nashville, TN 37208, USADepartment of Biochemistry and Cancer Biology, Meharry Medical College, Nashville, TN 37208, USADepartment of Biochemistry and Cancer Biology, Meharry Medical College, Nashville, TN 37208, USADepartment of Biochemistry and Cancer Biology, Meharry Medical College, Nashville, TN 37208, USADepartment of Biochemistry and Cancer Biology, Meharry Medical College, Nashville, TN 37208, USAThiazolidinediones (TZDs) dramatically reduce the growth of human prostate cancer cells in vitro and in vivo. To determine whether the antitumor effects of TZDs were due in part to changes in the MEK/Erk signaling pathway, we examined the regulation of Erk phosphorylation by the TZD troglitazone within the PC-3 and C4-2 human prostate cancer cell lines. Western blot analysis revealed troglitazone-induced phosphorylation of Erk in both PC-3 and C4-2 cells. Troglitazone-induced increases in Erk phosphorylation were suppressed by the MEK inhibitor U0126 but not by the PPARγ antagonist GW9662. Pretreatment with U0126 did not alter the ability of troglitazone to regulate expression of two proteins that control cell cycle, p21, and c-Myc. Troglitazone was also still effective at reducing PC-3 proliferation in the presence of U0126. Therefore, our data suggest that troglitazone-induced Erk phosphorylation does not significantly contribute to the antiproliferative effect of troglitazone.http://dx.doi.org/10.1155/2012/929052 |
spellingShingle | Adrienne Bolden Lynikka Bernard Danielle Jones Tunde Akinyeke LaMonica V. Stewart The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells PPAR Research |
title | The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells |
title_full | The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells |
title_fullStr | The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells |
title_full_unstemmed | The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells |
title_short | The PPAR Gamma Agonist Troglitazone Regulates Erk 1/2 Phosphorylation via a PPARγ-Independent, MEK-Dependent Pathway in Human Prostate Cancer Cells |
title_sort | ppar gamma agonist troglitazone regulates erk 1 2 phosphorylation via a pparγ independent mek dependent pathway in human prostate cancer cells |
url | http://dx.doi.org/10.1155/2012/929052 |
work_keys_str_mv | AT adriennebolden theppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells AT lynikkabernard theppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells AT daniellejones theppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells AT tundeakinyeke theppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells AT lamonicavstewart theppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells AT adriennebolden ppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells AT lynikkabernard ppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells AT daniellejones ppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells AT tundeakinyeke ppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells AT lamonicavstewart ppargammaagonisttroglitazoneregulateserk12phosphorylationviaappargindependentmekdependentpathwayinhumanprostatecancercells |